PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2197s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 228aa    MW: 24553.4 Da    PI: 8.0714
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2197s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.91.2e-3349103358
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                          k+rY+eClkNhA+++GghavDGC+Efmps ge+gt +alkCaACgCHRnFHR+e+e
  Cagra.2197s0042.1.p  49 KMRYRECLKNHAVNIGGHAVDGCCEFMPS-GEDGTLDALKCAACGCHRNFHRKETE 103
                          789*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.4E-3050102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2650103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-2951101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.36652101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.0E-32151226IPR009057Homeodomain-like
SuperFamilySSF466897.17E-20152225IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-27165221IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MNFEEQEEDM EMSGVNPPGG YDSLSGEGAT SSGGGGGGGG GRNKGVGGKM RYRECLKNHA  60
VNIGGHAVDG CCEFMPSGED GTLDALKCAA CGCHRNFHRK ETEIVGGRGQ RVPTYYNRPP  120
QPHPPPGYLH LTSPTAAGQP YRPPMASADE EDTSNPSSSG GNTAKRFRTK FTAEQKEKML  180
AFAERLGWRI QKHDDVAVEQ FCAETGVRRQ VLKIWMHNNK NSLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-381632221675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4398410.0AF439841.1 Arabidopsis thaliana AT4g24660/F22K18_140 mRNA, complete cds.
GenBankAL0353560.0AL035356.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F22K18 (ESSAII project).
GenBankAL1615610.0AL161561.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 61.
GenBankAY1255630.0AY125563.1 Arabidopsis thaliana AT4g24660/F22K18_140 mRNA, complete cds.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286279.11e-140hypothetical protein CARUB_v10007856mg
SwissprotQ9SB611e-127ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLR0FAW71e-140R0FAW7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__1809__AT4G24660.11e-130(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45052454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-109homeobox protein 22